Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPV 18 Protein

Recombinant of HPV 18 protein

Product Specifications

Product Name Alternative

Papillomavirus, HPV, Papilloma Virus.

Source

E.Coli

Field of Research

Infectious Disease & Virology; Cancer Biology

Purity

Protein is >90% pure as determined by 10% PAGE (Coomassie staining) .

Form

Sterile filtered clear liquid formulation.

Notes

For research use only.

Applications Notes

Viral Antigens- Human Papilloma Virus

Preservative

Recombinant HPV-18 solution in PBS and 2M Urea.

AA Sequence

VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SULT2B1 Antibody, Rabbit Polyclonal
MBS8105311-01 0.1 mL

Anti-SULT2B1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-SULT2B1 Antibody, Rabbit Polyclonal
MBS8105311-02 5x 0.1 mL

Anti-SULT2B1 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Loricrin Rabbit Monoclonal Antibody
M05290 100 µL/Vial

Anti-Loricrin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human SLC26A8 Pre-designed siRNA Set B
SI015002B 1 Each

Human SLC26A8 Pre-designed siRNA Set B

Sign In for Pricing
View Details
BMS-690514
A3256-5.1 10 mM (in 1mL DMSO)

BMS-690514

Sign In for Pricing
View Details
RB1 Antibody
orb1273796 0.1 mg

RB1 Antibody

Sign In for Pricing
View Details