Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPV 11 Protein

Recombinant of HPV 11 protein

Product Specifications

Product Name Alternative

Papillomavirus, HPV, Papilloma Virus.

Source

E.Coli

Field of Research

Infectious Disease & Virology; Cancer Biology

Purity

Protein is >80% pure as determined by 10% PAGE (coomassie staining) .

Form

Sterile filtered clear liquid formulation.

Storage Conditions

Stability: Recombinant HPV-11 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Applications: Each laboratory should determine an optimum working titer for use in its particular application

Preservative

Recombinant HPV11 solution in PBS, 3M Urea and 100mM arginine.

AA Sequence

VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQMFARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKKKFGTKLSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Transgelin (TAGLN)
MBS2026846-01 0.1 mL

Polyclonal Antibody to Transgelin (TAGLN)

Sign In for Pricing
View Details
Polyclonal Antibody to Transgelin (TAGLN)
MBS2026846-02 0.2 mL

Polyclonal Antibody to Transgelin (TAGLN)

Sign In for Pricing
View Details
Polyclonal Antibody to Transgelin (TAGLN)
MBS2026846-03 0.5 mL

Polyclonal Antibody to Transgelin (TAGLN)

Sign In for Pricing
View Details
Polyclonal Antibody to Transgelin (TAGLN)
MBS2026846-04 1 mL

Polyclonal Antibody to Transgelin (TAGLN)

Sign In for Pricing
View Details
Polyclonal Antibody to Transgelin (TAGLN)
MBS2026846-05 5 mL

Polyclonal Antibody to Transgelin (TAGLN)

Sign In for Pricing
View Details
Polyclonal Antibody to Transgelin (TAGLN)
MBS2026846-06 5x 5 mL

Polyclonal Antibody to Transgelin (TAGLN)

Sign In for Pricing
View Details