Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPV 11 Protein

Recombinant of HPV 11 protein

Product Specifications

Product Name Alternative

Papillomavirus, HPV, Papilloma Virus.

Source

E.Coli

Field of Research

Infectious Disease & Virology; Cancer Biology

Purity

Protein is >80% pure as determined by 10% PAGE (coomassie staining) .

Form

Sterile filtered clear liquid formulation.

Storage Conditions

Stability: Recombinant HPV-11 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Applications: Each laboratory should determine an optimum working titer for use in its particular application

Preservative

Recombinant HPV11 solution in PBS, 3M Urea and 100mM arginine.

AA Sequence

VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQMFARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKKKFGTKLSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17ORF85
476611 100 µL

C17ORF85

Sign In for Pricing
View Details
FTSJD2 (CMTR1) Human Over-expression Lysate
orb1368631 20 µg

FTSJD2 (CMTR1) Human Over-expression Lysate

Sign In for Pricing
View Details
TIMD4/TIM4/TIM-4 Antibody
orb1536135 0.05 mg

TIMD4/TIM4/TIM-4 Antibody

Sign In for Pricing
View Details
TIMM17B Antibody
orb681791 100 µL

TIMM17B Antibody

Sign In for Pricing
View Details
TMEM14C Recombinant Protein (Human)
RP031963 100 µg

TMEM14C Recombinant Protein (Human)

Sign In for Pricing
View Details
AMZ2 Rabbit Polyclonal Antibody
orb511960 100 µg

AMZ2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details