Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHIKV E1 Protein

Recombinant of CHIKV E1 protein

Product Specifications

Source

Escherichia Coli

Purity

Protein is >90% pure as determined by SDS-PAGE.

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: CHIKV E1 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

Notes

For research use only.

Applications Notes

Viral Antigens- Chikungunya Virus

Preservative

Sterile Filtered solution containing PBS.

AA Sequence

PNTVGVPYKTLVNRPGYSPMVLEMELLSVTLEPTLSLDYITCEYKTVIPSPYVKCCGTAECKDKSLPDYSC KVFTGVYPFMWGGAYCFCDTENTQLSEAHVEKSESCKTEFASAYRAHTASASAKLRVLYQGNNVTVSAY ANGDHAVTVKDAKFIVGPMSSAWTPFDNKIVVYKGDVYNMDYPPFGAGRPGQFGDIQSRTPESEDVYAN TQLVLQRPSAGTVHVPYSQAPSGFKYWLKERGASLQHTAPFGCQIATNPVRAMNCAVGNMPISIDIPDAAF TRVVDAPSLTDMSCEVPACTHSSDFGGVAIIKYAASKKGKCAVHSMTNAVTIREAEIEVEGNSQLQISFSTAL ASAEFRVQVCSTQVHCAAECHPPKDHIVNYPASHTTLGVQDISVTAMSWVQKITG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYNM Protein Vector (Mouse) (pPM-C-HA)
PV235736 500 ng

SYNM Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Dll1 Rat shRNA Lentiviral Particle (Locus ID 84010)
TL711657V 500 µL Each

Dll1 Rat shRNA Lentiviral Particle (Locus ID 84010)

Sign In for Pricing
View Details
BBS12 Antibody
46337 100 µL

BBS12 Antibody

Sign In for Pricing
View Details
MAP7D3 Peptide
DF14283-BP 1 mg

MAP7D3 Peptide

Sign In for Pricing
View Details
Lentiviral human FOXP2 shRNA (UAS) - Lentiviral human FOXP2 shRNA (UAS, iRFP) plasmid
GTR15084172 1 Vial

Lentiviral human FOXP2 shRNA (UAS) - Lentiviral human FOXP2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Lrrc40 (NM_024194) Mouse Tagged ORF Clone Lentiviral Particle
MR223952L3V 200 µL

Lrrc40 (NM_024194) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details