WNV Pre-M Protein
Recombinant of WNV Pre-M protein
Product Specifications
Source
Escherichia Coli
Purity
Protein is >95% pure as determined by SDS-PAGE.
Storage Conditions
Stability: WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles
Notes
For research use only.
Applications Notes
Applications: Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems
Preservative
20mM phosphate buffer pH 7.5.
AA Sequence
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
912007 250 Pack (10 Label (s) x 25 Card)
CNL2GR G Die-cut & Printed Numbers & Letters
Sign In for Pricing
View Details 
ARP32953_P050-HRP 100 µL
ZNF398 Antibody - middle region : HRP (ARP32953_P050-HRP)
Sign In for Pricing
View Details 
K0270802 1.0 µg DNA
C9orf116 sgRNA CRISPR Lentivector (Human) (Target 1)
Sign In for Pricing
View Details FAB1327V-100UG 100 µg
Oligodendrocyte Marker O1 Alexa Fluor 405 Antibody
Sign In for Pricing
View Details