WNV Pre-M Protein
Recombinant of WNV Pre-M protein
Product Specifications
Source
Escherichia Coli
Purity
Protein is >95% pure as determined by SDS-PAGE.
Storage Conditions
Stability: WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles
Notes
For research use only.
Applications Notes
Applications: Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems
Preservative
20mM phosphate buffer pH 7.5.
AA Sequence
MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
250975-FITC 100 µL
RBP7 (Retinol Binding Protein 7, Cellular, CRBP4, CRBPIV, MGC70641) (FITC)
Sign In for Pricing
View Details 
abx517862 96 Tests
Human Integrin-Linked Protein Kinase (ILK) ELISA Kit
Sign In for Pricing
View Details