WNV Pre-M Protein

Escherichia Coli

Protein is >95% pure as determined by SDS-PAGE.

Stability: WNV Pre-M although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles

For research use only.

Applications: Antigen in ELISA and Western blots, excellent antigen for detection of West-Nile virus with minimal specificity problems

20mM phosphate buffer pH 7.5.

MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE