Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Human (HEK293, mFc)

SLAMF2/CD48 protein is a GPI-anchored glycoprotein that regulates immune cell function by interacting with CD2 and CD244. SLAMF2/CD48 Protein, Human (HEK293, mFc) is the recombinant human-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-human-hek-293-mfc.html

Smiles

QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

Molecular Formula

962 (Gene_ID) P09326 (Q27-S220) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

delta 2 Catenin (CTNND2) Human Gene Knockout Kit (CRISPR)
KN224464 1 Kit

delta 2 Catenin (CTNND2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (LAMP4/1830), CF488A conjugate, 0.1mg/mL
BNC881830-100 1x 100 µL

CD68 (Macrophage Marker) (LAMP4/1830), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Apc10 (ANAPC10) activation kit by CRISPRa
GA107081 1 Kit

Human Apc10 (ANAPC10) activation kit by CRISPRa

Sign In for Pricing
View Details
Enterokinase (TMPRSS15) (NM_002772) Human Over-expression Lysate
LY419121 100 µg

Enterokinase (TMPRSS15) (NM_002772) Human Over-expression Lysate

Sign In for Pricing
View Details
MUPCDH (CDHR5) Rabbit Polyclonal Antibody
TA374542 100 µL

MUPCDH (CDHR5) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Spleen
CS641506 5x 5 µm

Frozen Tissue Sections, Spleen

Sign In for Pricing
View Details