Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF2/CD48, Human (HEK293, mFc)

SLAMF2/CD48 protein is a GPI-anchored glycoprotein that regulates immune cell function by interacting with CD2 and CD244. SLAMF2/CD48 Protein, Human (HEK293, mFc) is the recombinant human-derived SLAMF2/CD48 protein, expressed by HEK293 , with C-mFc labeled tag.

Product Specifications

Product Name Alternative

SLAMF2/CD48 Protein, Human (HEK293, mFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slamf2-cd48-protein-human-hek-293-mfc.html

Smiles

QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS

Molecular Formula

962 (Gene_ID) P09326 (Q27-S220) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

14-3-3 beta (YWHAB) Rabbit Polyclonal Antibody
TA385578 100 µL

14-3-3 beta (YWHAB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARL6IP4 Human qPCR Primer Pair (NM_018694)
HP231076 200 Reactions

ARL6IP4 Human qPCR Primer Pair (NM_018694)

Sign In for Pricing
View Details
TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (rTIMP2/2335), CF488A conjugate, 0.1mg/mL
BNC882335-100 1x 100 µL

TIMP2 (Tissue Inhibitor of Metalloproteinase 2) (rTIMP2/2335), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti Human ASF1A Polyclonal
Y054886 100 µL

Anti Human ASF1A Polyclonal

Sign In for Pricing
View Details
Recombinant eIF3B Antibody
RC-6982-01 50 μL

Recombinant eIF3B Antibody

Sign In for Pricing
View Details
Recombinant eIF3B Antibody
RC-6982-02 100 µL

Recombinant eIF3B Antibody

Sign In for Pricing
View Details