Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 19 (TRBV19)

Product Specifications

Abbreviation

Recombinant Human TRBV19 protein

Gene Name

TRBV19

UniProt

A0A075B6N1

Expression Region

22-114aa

Organism

Homo sapiens (Human)

Target Sequence

GITQSPKYLFRKEGQNVTLSCEQNLNHDAMYWYRQDPGQGLRLIYYSQIVNDFQKGDIAEGYSVSREKKESFPLTVTSAQKNPTAFYLCASSI

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Neuroscience

Relevance

V region of the variable domain of T cell receptor (TR) beta chain that participates in the antigen recognition. Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are present on the cell surface of T lymphocytes. Recognize peptide-major histocompatibility (MH) (pMH) complexes that are displayed by antigen presenting cells (APC), a prerequisite for efficient T cell adaptive immunity against pathogens. Binding of alpha-beta TR to pMH complex initiates TR-CD3 clustering on the cell surface and intracellular activation of LCK that phosphorylates the ITAM motifs of CD3G, CD3D, CD3E and CD247 enabling the recruitment of ZAP70. In turn ZAP70 phosphorylates LAT, which recruits numerous signaling molecules to form the LAT signalosome. The LAT signalosome propagates signal branching to three major signaling pathways, the calcium, the mitogen-activated protein kinase (MAPK) kinase and the nuclear factor NF-kappa-B (NF-kB) pathways, leading to the mobilization of transcription factors that are critical for gene expression and essential for T cell growth and differentiation. The T cell repertoire is generated in the thymus, by V- (D) -J rearrangement. This repertoire is then shaped by intrathymic selection events to generate a peripheral T cell pool of self-MH restricted, non-autoaggressive T cells. Post-thymic interaction of alpha-beta TR with the pMH complexes shapes TR structural and functional avidity.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

16.7 kDa

References & Citations

"Immunoglobulin and T Cell Receptor Genes: IMGT ((R) ) and the Birth and Rise of Immunoinformatics." Lefranc M.P. Front. Immunol. 5:22-22 (2014)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12934420/

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PE/Fire™ 744 anti-human CD152 (CTLA-4)
GT15144 100 Tests

PE/Fire™ 744 anti-human CD152 (CTLA-4)

Ask
View Details
UGT3A2 Antibody
55-144 400 µL

UGT3A2 Antibody

Ask
View Details
OR4C10P siRNA Oligos set (Human)
35175171 3 x 5 nmol

OR4C10P siRNA Oligos set (Human)

Ask
View Details
pCMV-SPORT6-Stx19 Plasmid
PVT56784 2 µg

pCMV-SPORT6-Stx19 Plasmid

Ask
View Details
PE-Linked Polyclonal Antibody to Connective Tissue Growth Factor (CTGF)
MBS2034981-01 0.1 mL

PE-Linked Polyclonal Antibody to Connective Tissue Growth Factor (CTGF)

Ask
View Details
PE-Linked Polyclonal Antibody to Connective Tissue Growth Factor (CTGF)
MBS2034981-02 0.2 mL

PE-Linked Polyclonal Antibody to Connective Tissue Growth Factor (CTGF)

Ask
View Details