IL-7, Mouse (HEK293, His)
IL-7, a hematopoietic cytokine, regulates lymphocyte population and maintains lymphoid homeostasis. IL-7 binds to its receptor complex IL7RA and CSF2RG, activating kinases like JAK1 or JAK3 depending on the cell type. This triggers downstream signaling pathways, including PI3K/Akt/mTOR or JAK-STAT5, leading to various cellular responses. IL-7's interaction with IL7R and CSF2RG is crucial for its diverse effects. IL-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-7 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
IL-7 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-7-protein-mouse-hek293-his.html
Purity
95.0
Smiles
ECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
Molecular Formula
16196 (Gene_ID) P10168/Q544C8/NP_032397.1 (E26-I154) (Accession)
Molecular Weight
Approximately 22-28 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
Platelet Derived Growth Factor Subunit B (PDGFB) BioAssayTM ELISA Kit (Human)
Recombinant Human CPVL/ Carboxypeptidase Protein, His-SUMO, E.coli-10ug