Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cation channel sperm-associated protein 1 (CATSPER1), partial

Product Specifications

Product Name Alternative

(CatSper1) (hCatSper)

Abbreviation

Recombinant Human CATSPER1 protein, partial

Gene Name

CATSPER1

UniProt

Q8NEC5

Expression Region

1-445aa

Organism

Homo sapiens (Human)

Target Sequence

MDQNSVPEKAQNEADTNNADRFFRSHSSPPHHRPGHSRALHHYELHHHGVPHQRGESHHPPEFQDFHDQALSSHVHQSHHHSEARNHGRAHGPTGFGLAPSQGAVPSHRSYGEDYHDELQRDGRRHHDGSQYGGFHQQSDSHYHRGSHHGRPQYLGENLSHYSSGVPHHGEASHHGGSYLPHGPNPYSESFHHSEASHLSGLQHDESQHHQVPHRGWPHHHQVHHHGRSRHHEAHQHGKSPHHGETISPHSSVGSYQRGISDYHSEYHQGDHHPSEYHHGDHPHHTQHHYHQTHRHRDYHQHQDHHGAYHSSYLHGDYVQSTSQLSIPHTSRSLIHDAPGPAASRTGVFPYHVAHPRGSAHSMTRSSSTIRSRVTQMSKKVHTQDISTKHSEDWGKEEGQFQKRKTGRLQRTRKKGHSTNLFQWLWEKLTFLIQGFREMIRNLTQ

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Voltage-gated calcium channel that plays a central role in calcium-dependent physiological responses essential for successful fertilization, such as sperm hyperactivation, acrosome reaction and chemotaxis towards the oocyte.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

52.7 kDa

References & Citations

"The CatSper channel mediates progesterone-induced Ca2+ influx in human sperm." Strunker T., Goodwin N., Brenker C., Kashikar N.D., Weyand I., Seifert R., Kaupp U.B. Nature 471:382-386 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (H+L) (RT-97 + NR-4), CF594 conjugate, 0.1mg/mL
BNC941201-500 1x 500 µL

Neurofilament (H+L) (RT-97 + NR-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Isocitrate Microplate Assay Kit
RDSM185 100 Assays

Isocitrate Microplate Assay Kit

Sign In for Pricing
View Details
Arecaidine Ethyl Ester Hydrochloride
TRC-A767010-50MG 50 mg

Arecaidine Ethyl Ester Hydrochloride

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (F4), 1mg/mL
BNUM2180-50 1x 50 µL

EGFR (Epidermal Growth Factor Receptor) (F4), 1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse ALPL protein (His tag)
PDEM100267-01 20 µg

Recombinant Mouse ALPL protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse ALPL protein (His tag)
PDEM100267-02 100 µg

Recombinant Mouse ALPL protein (His tag)

Sign In for Pricing
View Details