Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARRB1/Beta-Arrestin 1, Human (His)

ARRB1/Beta-Arrestin 1 Protein, Human (His) expresses in E. coli with a His tag. ARRB1/beta-Arrestin 1, found in the hypothalamus (ARH) and in N-38 neurons, is a scaffolding protein organizing downstream signaling molecules and as an adaptor protein aiding in ER internalization after its activation[1].

Product Specifications

Product Name Alternative

ARRB1/Beta-Arrestin 1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/arrb1-beta-arrestin-1-protein-human-his.html

Purity

98.00

Smiles

MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNRHHHHHH

Molecular Formula

408 (Gene_ID) P49407 (M1-R418) (Accession)

Molecular Weight

Approximately 60.0 kDa

References & Citations

[1]Angela M Wong, et al. β-arrestin regulates estradiol membrane-initiated signaling in hypothalamic neurons. PLoS One. 2015 Mar 24;10 (3) :e0120530.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

IGFL4 Antibody
DF10111-01 100 µL

IGFL4 Antibody

Ask
View Details
IGFL4 Antibody
DF10111-02 200 µL

IGFL4 Antibody

Ask
View Details
Human Carboxyterminal propeptide of type III procollagen, PIIICP ELISA Kit
MBS163646-01 48 Well

Human Carboxyterminal propeptide of type III procollagen, PIIICP ELISA Kit

Ask
View Details
Human Carboxyterminal propeptide of type III procollagen, PIIICP ELISA Kit
MBS163646-02 96 Well

Human Carboxyterminal propeptide of type III procollagen, PIIICP ELISA Kit

Ask
View Details
Human Carboxyterminal propeptide of type III procollagen, PIIICP ELISA Kit
MBS163646-03 5x 96 Well

Human Carboxyterminal propeptide of type III procollagen, PIIICP ELISA Kit

Ask
View Details
Human Carboxyterminal propeptide of type III procollagen, PIIICP ELISA Kit
MBS163646-04 10x 96 Well

Human Carboxyterminal propeptide of type III procollagen, PIIICP ELISA Kit

Ask
View Details