Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RB1 Protein

Recombinant of human RB1 protein

Product Specifications

Product Name Alternative

RB, OSRC, RB-1, RB1, p105-Rb, OSTEOSARCOMA, RETINOBLASTOMA-RELATED, PP110, Retinoblastoma-associated protein.

Source

Escherichia Coli

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Retinoblastoma in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Retinoblastoma should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The RB1 was lyophilized from 1xPBS pH-7.4.

AA Sequence

MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quercetin 3-gentiobioside
AB1980 20 mg

Quercetin 3-gentiobioside

Sign In for Pricing
View Details
Recombinant Mouse CXCL16 protein
CD00495 5 µg

Recombinant Mouse CXCL16 protein

Sign In for Pricing
View Details
STRAP, CT (Serine-threonine Kinase Receptor-associated Protein, MAP Activator With WD Repeats, MAWD, PT-WD, UNR-interacting Protein, UNRIP, WD-40 Repeat Protein PT-WD) (Biotin) discontinued
S7973-68-Biotin 200 µL

STRAP, CT (Serine-threonine Kinase Receptor-associated Protein, MAP Activator With WD Repeats, MAWD, PT-WD, UNR-interacting Protein, UNRIP, WD-40 Repeat Protein PT-WD) (Biotin) discontinued

Sign In for Pricing
View Details
Ahnak sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6382708 1.0 µg DNA

Ahnak sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rabbit Monoclonal LSM1 Antibody (022) [DyLight 488]
NBP2-90268G 0.1 mL

Rabbit Monoclonal LSM1 Antibody (022) [DyLight 488]

Sign In for Pricing
View Details
ASK1 Antibody
AF6548-01 100 µL

ASK1 Antibody

Sign In for Pricing
View Details