Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RB1 Protein

Recombinant of human RB1 protein

Product Specifications

Product Name Alternative

RB, OSRC, RB-1, RB1, p105-Rb, OSTEOSARCOMA, RETINOBLASTOMA-RELATED, PP110, Retinoblastoma-associated protein.

Source

Escherichia Coli

Field of Research

Epigenetics & Chromatin

Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized Retinoblastoma in sterile 18MΩ-cm H2O not less than 100 μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Retinoblastoma should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The RB1 was lyophilized from 1xPBS pH-7.4.

AA Sequence

MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EpCAM Polyclonal Antibody, AbBy Fluor™ 647 Conjugated
bs-1513R-BF647-TR 20 µL

EpCAM Polyclonal Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
C1orf177 CRISPR Activation Plasmid (h2)
sc-405258-ACT-2 20 µg

C1orf177 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (LN53), CF647 conjugate, 0.1mg/mL
BNC471746-100 1x 100 µL

Human Herpes Virus 8 (HHV8) (LN53), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
POLE3 Rabbit pAb
MBS8546135-01 0.1 mL

POLE3 Rabbit pAb

Sign In for Pricing
View Details
POLE3 Rabbit pAb
MBS8546135-02 0.1 mL (AF405L)

POLE3 Rabbit pAb

Sign In for Pricing
View Details
POLE3 Rabbit pAb
MBS8546135-03 0.1 mL (AF405S)

POLE3 Rabbit pAb

Sign In for Pricing
View Details