What is the catalog number for Human MICA Protein?

The catalog number for Human MICA Protein is orb427093.

What sizes are available for Human MICA Protein?

Human MICA Protein is available in the following size(s): 2 µg, 10 µg, 1 mg.

How many pack sizes does Human MICA Protein come in?

Human MICA Protein is available in 3 different pack sizes.

Is Human MICA Protein in stock?

Human MICA Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human MICA Protein

Recombinant of human MICA protein

Product Specifications

Product Name Alternative

MHC class I polypeptide-related sequence A, MIC-A, MICA, PERB11.1, HLA-B, AS, HLAB, HLAC, SPDA1, HLA-B73, HLA-B-7301.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Bioactivity

Measured by its ability to bind MICA antibody in ELISA.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized MICA in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized MICA although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MICA should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

Lyophilized from a concentrated (1mg/ml) solution containing no additives.

AA Sequence

EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH