Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAP Protein

Recombinant of RAP protein

Product Specifications

Product Name Alternative

Receptor Associated Protein, RAP.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile Filtered White lyophilized (freeze-dried) powder.

Solubility

It is recommended to reconstitute the lyophilized RAP Rat in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.

Storage Conditions

Stability: Lyophilized RAP Rat although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution RAP Rat should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Note: Ligand binding to RAP is Ca2+ dependent and e.g. lipid receptors can be released from RAP by a buffer containing 10mM EDTA. Furthermore, buffers containing phosphate should be avoided (it would form precipitates with Ca2+)

Preservative

The protein (1mg/ml) was lyophilized after from a sterile solution containing TBS pH-7.5, 0.1% rAlbumin and 0.09% NaN3.

AA Sequence

MAPLRDRVSTLPRLQLLVLLLLPLLLVPQPIAGHGGKYSREKNEPEMAAKRESGEEFRME KLNQLWEKAKRLHLSPVRLAELHSDLKIQERDELNWKKLKVEGLDGDGEKEAKLVHNLNV ILARYGLDGRKDTQTVHSNALNEDTQDELGDPRLEKLWHKAKTSGKFSSEELDKLWREFL HYKEKIHEYNVLLDTLSRAEEGYENLLSPSDMTHIKSDTLASKHSELKDRLRSINQGLDR LRKVSHQGYGPATEFEEPRVIDLWDLAQSANFTEKELESFREELKHFEAKIEKHNHYQKQ LEISHQKLKHVESIGDPEHISRNKEKYVLLEEKTKELGYKVKKHLQDLSSRVSRARHNEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBF, CT (CCAAT/Enhancer-binding Protein zeta, CCAAT-box-binding Transcription Factor, CCAAT-binding Factor, CBF, CEBPZ, CBF2)
C2098-04 200 µL

CBF, CT (CCAAT/Enhancer-binding Protein zeta, CCAAT-box-binding Transcription Factor, CCAAT-binding Factor, CBF, CEBPZ, CBF2)

Sign In for Pricing
View Details
Isoproturon-diflufenican mixt.
orb1985938-01 100 mg

Isoproturon-diflufenican mixt.

Sign In for Pricing
View Details
Isoproturon-diflufenican mixt.
orb1985938-02 500 mg

Isoproturon-diflufenican mixt.

Sign In for Pricing
View Details
IDE Inhibitor 6bK
IDE-3798-PI-01 1 mg

IDE Inhibitor 6bK

Sign In for Pricing
View Details
IDE Inhibitor 6bK
IDE-3798-PI-02 5 mg

IDE Inhibitor 6bK

Sign In for Pricing
View Details
Recombinant Mycobacterium phage D29 Gene 69 protein (69)
MBS1099306-01 0.02 mg (E-Coli)

Recombinant Mycobacterium phage D29 Gene 69 protein (69)

Sign In for Pricing
View Details