Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SUMO2 Protein

Recombinant of human SUMO2 protein

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: Can be stored at +4C for 1 week. For long term storage , below -2°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The SUMO2 (1mg/ml) containing 20mM Tris-HCl buffer (pH 8.0) .

AA Sequence

MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NPL4 (NPLOC4) (NM_017921) Human Recombinant Protein
PROTQ8TAT6 20 µg

NPL4 (NPLOC4) (NM_017921) Human Recombinant Protein

Sign In for Pricing
View Details
BAG5 Antibody, FITC conjugated
A71186-100UG 100 µg

BAG5 Antibody, FITC conjugated

Sign In for Pricing
View Details
LUC7L Protein Vector (Mouse) (pPM-C-HA)
27777024 500 ng

LUC7L Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Fam104a Mouse qPCR Template Standard (NM_138598)
MK204146 1 Kit

Fam104a Mouse qPCR Template Standard (NM_138598)

Sign In for Pricing
View Details
SNAPC1 Rabbit pAb (APR22298N)
APR22298N-01 50 µL

SNAPC1 Rabbit pAb (APR22298N)

Sign In for Pricing
View Details
SNAPC1 Rabbit pAb (APR22298N)
APR22298N-02 100 µL

SNAPC1 Rabbit pAb (APR22298N)

Sign In for Pricing
View Details