Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SUMO2 Protein

Recombinant of human SUMO2 protein

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: Can be stored at +4C for 1 week. For long term storage , below -2°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The SUMO2 (1mg/ml) containing 20mM Tris-HCl buffer (pH 8.0) .

AA Sequence

MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC2 Antibody
30-627 100 µL

APC2 Antibody

Sign In for Pricing
View Details
POU2F1 Antibody
OACD06203-1ML 1 mL

POU2F1 Antibody

Sign In for Pricing
View Details
Human ACHA6 full length protein-synthetic nanodisc
MBS1883128-01 0.01 mg

Human ACHA6 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human ACHA6 full length protein-synthetic nanodisc
MBS1883128-02 0.05 mg

Human ACHA6 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human ACHA6 full length protein-synthetic nanodisc
MBS1883128-03 0.1 mg

Human ACHA6 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
EEF1B2 Antibody
MBS7044148-01 0.05 mL

EEF1B2 Antibody

Sign In for Pricing
View Details