Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SUMO2 Protein

Recombinant of human SUMO2 protein

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: Can be stored at +4C for 1 week. For long term storage , below -2°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The SUMO2 (1mg/ml) containing 20mM Tris-HCl buffer (pH 8.0) .

AA Sequence

MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPP21 Human Gene Knockout Kit (CRISPR)
KN403959 1 Kit

RPP21 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Ak1 Recombinant Protein
PROTQ9R0Y5-10ug 10 µg

Mouse Ak1 Recombinant Protein

Sign In for Pricing
View Details
Recombinant Chicken Cytochrome c-type heme lyase (HCCS)
MBS1370436-01 0.02 mg (E-Coli)

Recombinant Chicken Cytochrome c-type heme lyase (HCCS)

Sign In for Pricing
View Details
Recombinant Chicken Cytochrome c-type heme lyase (HCCS)
MBS1370436-02 0.02 mg (Yeast)

Recombinant Chicken Cytochrome c-type heme lyase (HCCS)

Sign In for Pricing
View Details
Recombinant Chicken Cytochrome c-type heme lyase (HCCS)
MBS1370436-03 0.1 mg (E-Coli)

Recombinant Chicken Cytochrome c-type heme lyase (HCCS)

Sign In for Pricing
View Details
Recombinant Chicken Cytochrome c-type heme lyase (HCCS)
MBS1370436-04 0.1 mg (Yeast)

Recombinant Chicken Cytochrome c-type heme lyase (HCCS)

Sign In for Pricing
View Details