Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SUMO2 Protein

Recombinant of human SUMO2 protein

Product Specifications

Product Name Alternative

Small ubiquitin-related modifier 2, SUMO-2, Ubiquitin-like protein SMT3B, SMT3 homolog 2, Sentrin-2, HSMT3, SUMO-3, SUMO2, SMT3B, SMT3H2, MGC117191.

Source

Escherichia Coli

Purity

Greater than 95.0% as determined by SDS-PAGE.

Form

Sterile filtered colorless solution.

Storage Conditions

Stability: Can be stored at +4C for 1 week. For long term storage , below -2°C.Please prevent freeze-thaw cycles

Notes

For research use only.

Applications Notes

Recombinant & Natural Proteins

Preservative

The SUMO2 (1mg/ml) containing 20mM Tris-HCl buffer (pH 8.0) .

AA Sequence

MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (2-Bromo-4-fluorophenyl) thiourea
sc-328990A 5 mg

N- (2-Bromo-4-fluorophenyl) thiourea

Sign In for Pricing
View Details
CXCL16 antibody
MBS535836-01 0.05 mg

CXCL16 antibody

Sign In for Pricing
View Details
CXCL16 antibody
MBS535836-02 5x 0.05 mg

CXCL16 antibody

Sign In for Pricing
View Details
TA2R4 Human Recombinant Protein, Synthetic Nanodisc
TP721843M 100 µg

TA2R4 Human Recombinant Protein, Synthetic Nanodisc

Sign In for Pricing
View Details
6,7-Dihydro-5H-cyclopenta[b]pyridine-3-carboxylic Acid
TRC-D453723-250MG 250 mg

6,7-Dihydro-5H-cyclopenta[b]pyridine-3-carboxylic Acid

Sign In for Pricing
View Details
Biotin-C5-Azide
C8282-25 25 mg

Biotin-C5-Azide

Sign In for Pricing
View Details