Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Enterotoxin type B (entB)

Product Specifications

Product Name Alternative

(SEB)

Abbreviation

Recombinant Staphylococcus aureus entB protein

Gene Name

EntB

UniProt

P01552

Expression Region

28-266aa

Organism

Staphylococcus aureus

Target Sequence

ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Staphylococcal enterotoxin that activates the host immune system by binding as unprocessed molecules to major histocompatibility (MHC) complex class II and T-cell receptor (TCR) molecules. In turn, this ternary complex activates a large number of T-lymphocytes initiating a systemic release of pro-inflammatory cytokines. Causes also the intoxication staphylococcal food poisoning syndrome.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.3 kDa

References & Citations

Nucleotide sequence of the enterotoxin B gene from Staphylococcus aureus.Jones C.L., Khan S.A.J. Bacteriol. 166:29-33 (1986)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dystrobrevin beta (DTNB) (NM_033147) Human Tagged Lenti ORF Clone
RC220372L3 10 µg

Dystrobrevin beta (DTNB) (NM_033147) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Uncharacterized protein in pqq-V 5'region Antibody
MBS7143126 Inquire

Uncharacterized protein in pqq-V 5'region Antibody

Sign In for Pricing
View Details
MIRacle™ mmu-miR-7657-3p miRNA Agomir/Antagomir
AM3369 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-7657-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
MGAT3 Human shRNA Lentiviral Particle (Locus ID 4248)
TL311485V 500 µL Each

MGAT3 Human shRNA Lentiviral Particle (Locus ID 4248)

Sign In for Pricing
View Details
PSMA3 siRNA (Rat)
CRR1309-01 15 nmol

PSMA3 siRNA (Rat)

Sign In for Pricing
View Details
PSMA3 siRNA (Rat)
CRR1309-02 30 nmol

PSMA3 siRNA (Rat)

Sign In for Pricing
View Details