Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLRT1, Human (HEK293, His)

FLRT1 is a key player in FGF-mediated signaling, activating MAP kinase and enhancing neurite outgrowth through FGFR1-mediated signaling.It helps increase the number and length of neurites. FLRT1 Protein, Human (HEK293, His) is the recombinant human-derived FLRT1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FLRT1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/flrt1-protein-human-hek-293-his.html

Purity

95.00

Smiles

IDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLP

Molecular Formula

23769 (Gene_ID) Q9NZU1 (I21-P524) (Accession)

Molecular Weight

60-85 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRXRD2/SELZ Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-8628R-APC-Cy5.5 100 µL

TRXRD2/SELZ Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
RN5S406 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
39992061 1.0 µg DNA

RN5S406 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
2310014L17Rik Protein Vector (Mouse) (pPM-C-HA)
PV147980 500 ng

2310014L17Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PRKD2 CRISPRa sgRNA lentivector (set of three targets)(Human)
37649121 3x 1.0µg DNA

PRKD2 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
SCARNA7 sgRNA CRISPR Lentivector (Human) (Target 2)
K2096503 1.0 µg DNA

SCARNA7 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Easypro Human Gal (Galanin) ELISA Kit
FY-EH1741S 96 Well

Easypro Human Gal (Galanin) ELISA Kit

Sign In for Pricing
View Details