Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLRT1, Human (HEK293, His)

FLRT1 is a key player in FGF-mediated signaling, activating MAP kinase and enhancing neurite outgrowth through FGFR1-mediated signaling.It helps increase the number and length of neurites. FLRT1 Protein, Human (HEK293, His) is the recombinant human-derived FLRT1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FLRT1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/flrt1-protein-human-hek-293-his.html

Purity

95.00

Smiles

IDSTTCPSVCRCDNGFIYCNDRGLTSIPADIPDDATTLYLQNNQINNAGIPQDLKTKVNVQVIYLYENDLDEFPINLPRSLRELHLQDNNVRTIARDSLARIPLLEKLHLDDNSVSTVSIEEDAFADSKQLKLLFLSRNHLSSIPSGLPHTLEELRLDDNRISTIPLHAFKGLNSLRRLVLDGNLLANQRIADDTFSRLQNLTELSLVRNSLAAPPLNLPSAHLQKLYLQDNAISHIPYNTLAKMRELERLDLSNNNLTTLPRGLFDDLGNLAQLLLRNNPWFCGCNLMWLRDWVKARAAVVNVRGLMCQGPEKVRGMAIKDITSEMDECFETGPQGGVANAAAKTTASNHASATTPQGSLFTLKAKRPGLRLPDSNIDYPMATGDGAKTLAIHVKALTADSIRITWKATLPASSFRLSWLRLGHSPAVGSITETLVQGDKTEYLLTALEPKSTYIICMVTMETSNAYVADETPVCAKAETADSYGPTTTLNQEQNAGPMASLP

Molecular Formula

23769 (Gene_ID) Q9NZU1 (I21-P524) (Accession)

Molecular Weight

60-85 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF640R conjugate, 0.1mg/mL
BNC400851-500 1x 500 µL

HSP60 (LK1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5), CF568 conjugate, 0.1mg/mL
BNC680698-100 1x 100 µL

Chromogranin A (LK2H10 + PHE5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF488A conjugate, 0.1mg/mL
BNC880160-500 1x 500 µL

CD20 (B9E9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR484), CF488A conjugate, 0.1mg/mL
BNC880484-500 1x 500 µL

Progesterone Receptor (PR484), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF488A conjugate, 0.1mg/mL
BNC881812-500 1x 500 µL

MART-1 / Melan-A / MLANA (Melanoma Marker) (rMLANA/788), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details