Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293)

CD47 is an adhesion protein that regulates integrin signaling through G protein activation and serves as a receptor for thrombospondin THBS1, affecting signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, self-renewal and Immunomodulatory. It regulates pulmonary endothelin EDN1 signaling, acts as a pressor in blood pressure regulation, and is critical for memory formation. CD47 Protein, Human (HEK293) is the recombinant human-derived CD47 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293.html

Purity

95.0

Smiles

MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1/NP_942088.1 (Q19-P139) (Accession)

Molecular Weight

35-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GARNL3 activation kit by CRISPRa
GA113451 1 Kit

Human GARNL3 activation kit by CRISPRa

Sign In for Pricing
View Details
FBS Exosome Depletion Kit II (Slurry Format)
61400 12 Prepartions

FBS Exosome Depletion Kit II (Slurry Format)

Sign In for Pricing
View Details
Human epithelial Sodium Channel gamma (SCNN1G) activation kit by CRISPRa
GA104305 1 Kit

Human epithelial Sodium Channel gamma (SCNN1G) activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501121 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Apoe Mouse Gene Knockout Kit (CRISPR)
KN501421 1 Kit

Apoe Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
BNC400266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details