Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293)

CD47 is an adhesion protein that regulates integrin signaling through G protein activation and serves as a receptor for thrombospondin THBS1, affecting signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, self-renewal and Immunomodulatory. It regulates pulmonary endothelin EDN1 signaling, acts as a pressor in blood pressure regulation, and is critical for memory formation. CD47 Protein, Human (HEK293) is the recombinant human-derived CD47 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293.html

Purity

95.0

Smiles

MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1/NP_942088.1 (Q19-P139) (Accession)

Molecular Weight

35-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCF1 Recombinant Rabbit Monoclonal Antibody [SN07-12]
ET1611-63 100 µL

ABCF1 Recombinant Rabbit Monoclonal Antibody [SN07-12]

Sign In for Pricing
View Details
Bestrophin 3 (BEST3) Human Gene Knockout Kit (CRISPR)
KN416701 1 Kit

Bestrophin 3 (BEST3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791 +1A4), CF647 conjugate, 0.1mg/mL
BNC471203-500 1x 500 µL

Smooth Muscle Actin (ACTA2/791 +1A4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Golgi Complex (371-4), Biotin conjugate, 0.1mg/mL
BNCB0102-100 1x 100 µL

Golgi Complex (371-4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSUN5 Human Gene Knockout Kit (CRISPR)
KN200144LP 1 Kit

NSUN5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZAP70 (ZAP70/528 + 2F3.2), Biotin conjugate, 0.1mg/mL
BNCB1137-100 1x 100 µL

ZAP70 (ZAP70/528 + 2F3.2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details