Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD47, Human (HEK293)

CD47 is an adhesion protein that regulates integrin signaling through G protein activation and serves as a receptor for thrombospondin THBS1, affecting signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, self-renewal and Immunomodulatory. It regulates pulmonary endothelin EDN1 signaling, acts as a pressor in blood pressure regulation, and is critical for memory formation. CD47 Protein, Human (HEK293) is the recombinant human-derived CD47 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

CD47 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd47-protein-human-hek293.html

Purity

95.0

Smiles

MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Molecular Formula

961 (Gene_ID) Q08722-1/NP_942088.1 (Q19-P139) (Accession)

Molecular Weight

35-48 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA2 Rabbit Polyclonal Antibody
ER2001-20 100 µL

DNA2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IFluor® 560 maleimide
71684-AAT 1 mg

IFluor® 560 maleimide

Sign In for Pricing
View Details
TNFAIP3 Human Gene Knockout Kit (CRISPR)
KN421337 1 Kit

TNFAIP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TAZ (WWTR1) Rabbit Polyclonal Antibody
TA370025 100 µL

TAZ (WWTR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2',4'-Dihydroxy-2-benzoylbenzoic Acid
TRC-D451750-1G 1 g

2',4'-Dihydroxy-2-benzoylbenzoic Acid

Sign In for Pricing
View Details
mPlum Escherichia coli Recombinant Protein
TP790042 250 µg

mPlum Escherichia coli Recombinant Protein

Sign In for Pricing
View Details