Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS3/Trypsin-3, Human (His)

PRSS3/Trypsin-3 is a digestive protease with specific substrate preference that cleaves proteins after Arg residues. This enzymatic activity is combined with its ability to exhibit proteolytic effects on Kunitz-type trypsin inhibitors. PRSS3/Trypsin-3 Protein, Human (His) is the recombinant human-derived PRSS3/Trypsin-3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRSS3/Trypsin-3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trypsin-3-prss3-protein-human-his.html

Purity

95.00

Smiles

IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN

Molecular Formula

5646 (Gene_ID) P35030-1 (I81-N303) (Accession)

Molecular Weight

Approximately 28.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEIL1 Antibody
8C15633-AAT 50 µg

NEIL1 Antibody

Sign In for Pricing
View Details
Complement 3d (C3d) (Acute Humoral Rejection Marker) (C3D/2891), CF740 conjugate, 0.1mg/mL
BNC742891-500 1x 500 µL

Complement 3d (C3d) (Acute Humoral Rejection Marker) (C3D/2891), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HEY1 (NM_012258) Human Recombinant Protein
TP761353 50 µg

HEY1 (NM_012258) Human Recombinant Protein

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL
BNC400158-100 1x 100 µL

Cytokeratin 17 (E3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,7-Diazapyrene
TRC-D417648-25MG 25 mg

2,7-Diazapyrene

Sign In for Pricing
View Details
Tyrosinase (Melanoma Marker) (rOCA1/812), CF568 conjugate, 0.1mg/mL
BNC682215-500 1x 500 µL

Tyrosinase (Melanoma Marker) (rOCA1/812), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details