Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS3/Trypsin-3, Human (His)

PRSS3/Trypsin-3 is a digestive protease with specific substrate preference that cleaves proteins after Arg residues. This enzymatic activity is combined with its ability to exhibit proteolytic effects on Kunitz-type trypsin inhibitors. PRSS3/Trypsin-3 Protein, Human (His) is the recombinant human-derived PRSS3/Trypsin-3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRSS3/Trypsin-3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trypsin-3-prss3-protein-human-his.html

Purity

95.00

Smiles

IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN

Molecular Formula

5646 (Gene_ID) P35030-1 (I81-N303) (Accession)

Molecular Weight

Approximately 28.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Chloroacenaphthene
TRC-C353400-1MG 1 mg

3-Chloroacenaphthene

Sign In for Pricing
View Details
Accuris qMAX Probe, High Rox qPCR Mix, 1000 reactions
PR2001-H-1000 1 Each

Accuris qMAX Probe, High Rox qPCR Mix, 1000 reactions

Sign In for Pricing
View Details
FKBP14 Human Gene Knockout Kit (CRISPR)
KN402674 1 Kit

FKBP14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(S)-(-)-Nicotine-d4
TRC-N412452-1MG 1 mg

(S)-(-)-Nicotine-d4

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS714418 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Olig2 Antibody
KC-6152-01 50 μL

Olig2 Antibody

Sign In for Pricing
View Details