Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS3/Trypsin-3, Human (His)

PRSS3/Trypsin-3 is a digestive protease with specific substrate preference that cleaves proteins after Arg residues. This enzymatic activity is combined with its ability to exhibit proteolytic effects on Kunitz-type trypsin inhibitors. PRSS3/Trypsin-3 Protein, Human (His) is the recombinant human-derived PRSS3/Trypsin-3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRSS3/Trypsin-3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trypsin-3-prss3-protein-human-his.html

Purity

95.00

Smiles

IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN

Molecular Formula

5646 (Gene_ID) P35030-1 (I81-N303) (Accession)

Molecular Weight

Approximately 28.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 610 Styramide
44904-AAT 100 Slides

IFluor® 610 Styramide

Sign In for Pricing
View Details
1-Cyclopropyl-8-ethoxy-6,7-difluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid
TRC-C988520-50MG 50 mg

1-Cyclopropyl-8-ethoxy-6,7-difluoro-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid

Sign In for Pricing
View Details
Human ZNF790 activation kit by CRISPRa
GA117963 1 Kit

Human ZNF790 activation kit by CRISPRa

Sign In for Pricing
View Details
N-Iso Valerylglycine
TRC-I917600-500MG 500 mg

N-Iso Valerylglycine

Sign In for Pricing
View Details
Cell Fractionation Antibody Sampler Kit
HAK21080 1 Kit

Cell Fractionation Antibody Sampler Kit

Sign In for Pricing
View Details
Myosin (MYL4) Mouse Monoclonal Antibody [Clone ID: OTI2F6]
CF807581 100 µg

Myosin (MYL4) Mouse Monoclonal Antibody [Clone ID: OTI2F6]

Sign In for Pricing
View Details