Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS3/Trypsin-3, Human (His)

PRSS3/Trypsin-3 is a digestive protease with specific substrate preference that cleaves proteins after Arg residues. This enzymatic activity is combined with its ability to exhibit proteolytic effects on Kunitz-type trypsin inhibitors. PRSS3/Trypsin-3 Protein, Human (His) is the recombinant human-derived PRSS3/Trypsin-3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRSS3/Trypsin-3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trypsin-3-prss3-protein-human-his.html

Purity

95.00

Smiles

IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN

Molecular Formula

5646 (Gene_ID) P35030-1 (I81-N303) (Accession)

Molecular Weight

Approximately 28.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPV-16 (Human Papilloma Virus 16) (HPV16/1295), CF647 conjugate, 0.1mg/mL
BNC471295-100 1x 100 µL

HPV-16 (Human Papilloma Virus 16) (HPV16/1295), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Osteopontin Rabbit Polyclonal Antibody
0806-6 100 µL

Osteopontin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IgA Immunoglobulin (IA761), CF543 conjugate, 0.1mg/mL
BNC430761-500 1x 500 µL

Human IgA Immunoglobulin (IA761), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Bromopropane-d7
TRC-B687138-500MG 500 mg

1-Bromopropane-d7

Sign In for Pricing
View Details
Recombinant SMARCC2/BAF170 Monoclonal Antibody
AN302065L-01 50 µL

Recombinant SMARCC2/BAF170 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant SMARCC2/BAF170 Monoclonal Antibody
AN302065L-02 100 µL

Recombinant SMARCC2/BAF170 Monoclonal Antibody

Sign In for Pricing
View Details