Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS3/Trypsin-3, Human (His)

PRSS3/Trypsin-3 is a digestive protease with specific substrate preference that cleaves proteins after Arg residues. This enzymatic activity is combined with its ability to exhibit proteolytic effects on Kunitz-type trypsin inhibitors. PRSS3/Trypsin-3 Protein, Human (His) is the recombinant human-derived PRSS3/Trypsin-3 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

PRSS3/Trypsin-3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/trypsin-3-prss3-protein-human-his.html

Purity

95.00

Smiles

IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN

Molecular Formula

5646 (Gene_ID) P35030-1 (I81-N303) (Accession)

Molecular Weight

Approximately 28.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAP1GAP Protein Vector (Mouse) (pPM-C-HA)
PV222340 500 ng

RAP1GAP Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal Retinol Binding Protein RBP Antibody (RBP/872) [Alexa Fluor 647]
NBP2-48017AF647 0.1 mL

Mouse Monoclonal Retinol Binding Protein RBP Antibody (RBP/872) [Alexa Fluor 647]

Sign In for Pricing
View Details
Rabbit Polyclonal RGS10 Antibody
NBP1-86020 0.1 mL

Rabbit Polyclonal RGS10 Antibody

Sign In for Pricing
View Details
F13b ORF Vector (Mouse) (pORF)
19611014 1.0 µg DNA

F13b ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PNPLA4 Protein Vector (Human) (pPM-C-HA)
PV031971 500 ng

PNPLA4 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Kaiso (ZBTB33) (NM_006777) Human Tagged ORF Clone Lentiviral Particle
RC207287L4V 200 µL

Kaiso (ZBTB33) (NM_006777) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details