Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PR-Set7, Human

The PR-Set7 Protein methylates Lys-20 of histone H4, repressing gene transcription and aiding cell proliferation and chromatin condensation. It is expressed in multiple tissues, including the prostate (RPKM 17.6), esophagus (RPKM 16.8), and others. PR-Set7 Protein, Human is the recombinant human-derived PR-Set7 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

PR-Set7 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pr-set7-protein-human.html

Purity

96.00

Smiles

KAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH

Molecular Formula

387893 (Gene_ID) Q9NQR1-2/NP_065115 (K195-H352) (Accession)

Molecular Weight

Approximately 18 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIOX Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G7]
TA501455AM 100 µL

MIOX Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G7]

Sign In for Pricing
View Details
CD351/FCAMR Rabbit mAb
A25982-01 20 µL

CD351/FCAMR Rabbit mAb

Sign In for Pricing
View Details
CD351/FCAMR Rabbit mAb
A25982-02 100 μL

CD351/FCAMR Rabbit mAb

Sign In for Pricing
View Details
CD351/FCAMR Rabbit mAb
A25982-03 500 μL

CD351/FCAMR Rabbit mAb

Sign In for Pricing
View Details
CD351/FCAMR Rabbit mAb
A25982-04 1000 μL

CD351/FCAMR Rabbit mAb

Sign In for Pricing
View Details
IgM Antibody (Biotin)
orb436308 1 mg

IgM Antibody (Biotin)

Sign In for Pricing
View Details