CD19, Mouse (HEK293, His)
The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca (2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD19 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd19-protein-mouse-hek293-his.html
Purity
95.60
Smiles
GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG
Molecular Formula
12478 (Gene_ID) P25918 (R19-G287) (Accession)
Molecular Weight
Approximately 45-70 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1891308 1.0 µg DNA
RPL7P27 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
MBS6002024-01 0.2 mL
PLEKHA4, NT (PLEKHA4, PEPP1, Pleckstrin homology domain-containing family A member 4, Phosphoinositol 3-phosphate-binding protein 1)
Sign In for Pricing
View Details 
MBS6002024-02 5x 0.2 mL
PLEKHA4, NT (PLEKHA4, PEPP1, Pleckstrin homology domain-containing family A member 4, Phosphoinositol 3-phosphate-binding protein 1)
Sign In for Pricing
View Details FAB10501S-100UG 100 µg
Human APCDD1 Alexa Fluor 750 MAb (Clone 2584B)
Sign In for Pricing
View Details 
243076-ML650 100 µL
ACTN4 (Actinin, alpha 4, ActinIN-4, DKFZp686K23158, FSGS, FSGS1) (MaxLight 650)
Sign In for Pricing
View Details