CD19, Mouse (HEK293, His)
The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca (2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
CD19 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd19-protein-mouse-hek293-his.html
Purity
95.60
Smiles
GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG
Molecular Formula
12478 (Gene_ID) P25918 (R19-G287) (Accession)
Molecular Weight
Approximately 45-70 kDa due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC202910L1 10 µg
JM4 (PRAF2) (NM_007213) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 
VAng-Yyj1548-inquire Inquire
Recombinant Mycobacterium Leprae ML2453 Protein（aa 1-95)
Sign In for Pricing
View Details MBS2061908-01 0.1 mL
APC/CY7-Linked Polyclonal Antibody to Apolipoprotein B (APOB)
Sign In for Pricing
View Details