Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD19, Mouse (HEK293, His)

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca (2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD19 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd19-protein-mouse-hek293-his.html

Purity

95.60

Smiles

GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

Molecular Formula

12478 (Gene_ID) P25918 (R19-G287) (Accession)

Molecular Weight

Approximately 45-70 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Diamine Oxidase (DAO) ELISA Kit
EIA05560m 1 Kit

Mouse Diamine Oxidase (DAO) ELISA Kit

Sign In for Pricing
View Details
Transmembrane protein 88B (TMEM88B) Human siRNA Oligo Duplex (Locus ID 643965)
SR318767 1 Kit

Transmembrane protein 88B (TMEM88B) Human siRNA Oligo Duplex (Locus ID 643965)

Sign In for Pricing
View Details
Lentiviral mouse Npc1 shRNA (UAS) - Lentiviral mouse Npc1 shRNA (UAS) (25)
GTR15249485 1 Vial

Lentiviral mouse Npc1 shRNA (UAS) - Lentiviral mouse Npc1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Anti-CD327/SIGLEC6 Antibody (R2V02)
RHA75302 100 μg

Anti-CD327/SIGLEC6 Antibody (R2V02)

Sign In for Pricing
View Details
Phospho-Bim (Ser77) Antibody
AF2325-01 100 µL

Phospho-Bim (Ser77) Antibody

Sign In for Pricing
View Details
Phospho-Bim (Ser77) Antibody
AF2325-02 200 µL

Phospho-Bim (Ser77) Antibody

Sign In for Pricing
View Details