Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD19, Mouse (HEK293, His)

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca (2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD19 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd19-protein-mouse-hek293-his.html

Purity

95.60

Smiles

GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

Molecular Formula

12478 (Gene_ID) P25918 (R19-G287) (Accession)

Molecular Weight

Approximately 45-70 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fezf1 (NM_028462) Mouse Tagged ORF Clone Lentiviral Particle
MR222210L4V 200 µL

Fezf1 (NM_028462) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse monoclonal Cytochrome C antibody
MBS5305908-01 0.1 mg

Mouse monoclonal Cytochrome C antibody

Sign In for Pricing
View Details
Mouse monoclonal Cytochrome C antibody
MBS5305908-02 5x 0.1 mg

Mouse monoclonal Cytochrome C antibody

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Tubulin Delta (TUBd)
MBS2075195-01 0.1 mL

FITC-Linked Polyclonal Antibody to Tubulin Delta (TUBd)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Tubulin Delta (TUBd)
MBS2075195-02 0.2 mL

FITC-Linked Polyclonal Antibody to Tubulin Delta (TUBd)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Tubulin Delta (TUBd)
MBS2075195-03 0.5 mL

FITC-Linked Polyclonal Antibody to Tubulin Delta (TUBd)

Sign In for Pricing
View Details