Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD19, Mouse (HEK293, His)

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca (2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD19 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd19-protein-mouse-hek293-his.html

Purity

95.60

Smiles

GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

Molecular Formula

12478 (Gene_ID) P25918 (R19-G287) (Accession)

Molecular Weight

Approximately 45-70 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

GM2A, NT (GM2A, Ganglioside GM2 activator, Cerebroside sulfate activator protein, GM2-AP, Shingolipid activator protein 3, Ganglioside GM2 activator isoform short)
MBS641159-01 0.2 mL

GM2A, NT (GM2A, Ganglioside GM2 activator, Cerebroside sulfate activator protein, GM2-AP, Shingolipid activator protein 3, Ganglioside GM2 activator isoform short)

Ask
View Details
GM2A, NT (GM2A, Ganglioside GM2 activator, Cerebroside sulfate activator protein, GM2-AP, Shingolipid activator protein 3, Ganglioside GM2 activator isoform short)
MBS641159-02 5x 0.2 mL

GM2A, NT (GM2A, Ganglioside GM2 activator, Cerebroside sulfate activator protein, GM2-AP, Shingolipid activator protein 3, Ganglioside GM2 activator isoform short)

Ask
View Details
ELP4 Antibody, HRP conjugated
MBS7109449-01 0.05 mg

ELP4 Antibody, HRP conjugated

Ask
View Details
ELP4 Antibody, HRP conjugated
MBS7109449-02 0.1 mg

ELP4 Antibody, HRP conjugated

Ask
View Details
ELP4 Antibody, HRP conjugated
MBS7109449-03 5x 0.1 mg

ELP4 Antibody, HRP conjugated

Ask
View Details
Recombinant Klebsiella pneumoniae Recombination-associated protein rdgC (rdgC)
MBS1211035-01 0.02 mg (E-Coli)

Recombinant Klebsiella pneumoniae Recombination-associated protein rdgC (rdgC)

Ask
View Details