Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD19, Mouse (HEK293, His)

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca (2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD19 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd19-protein-mouse-hek293-his.html

Purity

95.60

Smiles

GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

Molecular Formula

12478 (Gene_ID) P25918 (R19-G287) (Accession)

Molecular Weight

Approximately 45-70 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Integrin, beta1, active (ITGB1, Integrin, beta 1 (Fibronectin Receptor, beta Polypeptide, Antigen CD29 includes MDF2, MSK12), CD29, Fibronectin Receptor Subunit beta, FNRB, GPIIA, MDF2, MSK12, VLA-4 Subunit beta, VLAB, VLA-BETA) (AP)
MBS6241718-01 0.1 mL

Integrin, beta1, active (ITGB1, Integrin, beta 1 (Fibronectin Receptor, beta Polypeptide, Antigen CD29 includes MDF2, MSK12), CD29, Fibronectin Receptor Subunit beta, FNRB, GPIIA, MDF2, MSK12, VLA-4 Subunit beta, VLAB, VLA-BETA) (AP)

Ask
View Details
Integrin, beta1, active (ITGB1, Integrin, beta 1 (Fibronectin Receptor, beta Polypeptide, Antigen CD29 includes MDF2, MSK12), CD29, Fibronectin Receptor Subunit beta, FNRB, GPIIA, MDF2, MSK12, VLA-4 Subunit beta, VLAB, VLA-BETA) (AP)
MBS6241718-02 5x 0.1 mL

Integrin, beta1, active (ITGB1, Integrin, beta 1 (Fibronectin Receptor, beta Polypeptide, Antigen CD29 includes MDF2, MSK12), CD29, Fibronectin Receptor Subunit beta, FNRB, GPIIA, MDF2, MSK12, VLA-4 Subunit beta, VLAB, VLA-BETA) (AP)

Ask
View Details
SCN2A CRISPR Knock Out 293T Cell Line (Human)
43178141 1x 10^6 Cells / 1.0 mL

SCN2A CRISPR Knock Out 293T Cell Line (Human)

Ask
View Details
DTYMK Mouse Monoclonal Antibody [Clone ID: LBI1C4]
AMM11727V 100 µL

DTYMK Mouse Monoclonal Antibody [Clone ID: LBI1C4]

Ask
View Details
Human DRD2 shRNA Plasmid
abx951265-01 150 µg

Human DRD2 shRNA Plasmid

Ask
View Details
Human DRD2 shRNA Plasmid
abx951265-02 300 µg

Human DRD2 shRNA Plasmid

Ask
View Details