Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD19, Mouse (HEK293, His)

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca (2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD19 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd19-protein-mouse-hek293-his.html

Purity

95.60

Smiles

GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

Molecular Formula

12478 (Gene_ID) P25918 (R19-G287) (Accession)

Molecular Weight

Approximately 45-70 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

AZIN 1 (Antizyme Inhibitor 1, OAZI, OAZIN, ODC1L, Ornithine Decarboxylase Antizyme Inhibitor, Ornithine Decarboxylase 1-Like)
362244 200 µL

AZIN 1 (Antizyme Inhibitor 1, OAZI, OAZIN, ODC1L, Ornithine Decarboxylase Antizyme Inhibitor, Ornithine Decarboxylase 1-Like)

Ask
View Details
Lentiviral human ACTN1 sgRNA gene knockout kit - Lentiviral human ACTN1 sgRNA gene knockout kit (25)
GTR15398217 1 Vial

Lentiviral human ACTN1 sgRNA gene knockout kit - Lentiviral human ACTN1 sgRNA gene knockout kit (25)

Ask
View Details
Mouse Connexin 31/GJB3 ELISA Kit (Colorimetric)
NBP2-79814 1 Kit

Mouse Connexin 31/GJB3 ELISA Kit (Colorimetric)

Ask
View Details
Brca2 (NM_031542) Rat Tagged ORF Clone
RR211711 10 µg

Brca2 (NM_031542) Rat Tagged ORF Clone

Ask
View Details
Bone Sialoprotein (BSP) Monkey ELISA Kit
B9439 96 Tests

Bone Sialoprotein (BSP) Monkey ELISA Kit

Ask
View Details