Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD19, Mouse (HEK293, His)

The CD19 protein acts as a coreceptor for B cell antigen receptors, lowering the signaling threshold and initiating B cell responses to antigens. It activates a cascade leading to PI3K activation and Ca (2+) mobilization. CD19 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD19 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD19 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd19-protein-mouse-hek293-his.html

Purity

95.60

Smiles

GGRPQKSLLVEVEEGGNVVLPCLPDSSPVSSEKLAWYRGNQSTPFLELSPGSPGLGLHVGSLGILLVIVNVSDHMGGFYLCQKRPPFKDIWQPAWTVNVEDSGEMFRWNASDVRDLDCDLRNRSSGSHRSTSGSQLYVWAKDHPKVWGTKPVCAPRGSSLNQSLINQDLTVAPGSTLWLSCGVPPVPVAKGSISWTHVHPRRPNVSLLSLSLGGEHPVREMWVWGSLLLLPQATALDEGTYYCLRGNLTIERHVKVIARSAVWLWLLRTGG

Molecular Formula

12478 (Gene_ID) P25918 (R19-G287) (Accession)

Molecular Weight

Approximately 45-70 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Tnfsf10 Mouse qPCR Primer Pair (NM_009425)
MP217736 200 Reactions

Tnfsf10 Mouse qPCR Primer Pair (NM_009425)

Ask
View Details
Mouse KRT81 siRNA
abx922032-01 15 nmol

Mouse KRT81 siRNA

Ask
View Details
Mouse KRT81 siRNA
abx922032-02 30 nmol

Mouse KRT81 siRNA

Ask
View Details
PAP2D, ID (LPPR5, PAP2D, Lipid phosphate phosphatase-related protein type 5, Phosphatidic acid phosphatase 2d, Plasticity-related gene 5 protein) (Biotin)
MBS6330727-01 0.2 mL

PAP2D, ID (LPPR5, PAP2D, Lipid phosphate phosphatase-related protein type 5, Phosphatidic acid phosphatase 2d, Plasticity-related gene 5 protein) (Biotin)

Ask
View Details
PAP2D, ID (LPPR5, PAP2D, Lipid phosphate phosphatase-related protein type 5, Phosphatidic acid phosphatase 2d, Plasticity-related gene 5 protein) (Biotin)
MBS6330727-02 5x 0.2 mL

PAP2D, ID (LPPR5, PAP2D, Lipid phosphate phosphatase-related protein type 5, Phosphatidic acid phosphatase 2d, Plasticity-related gene 5 protein) (Biotin)

Ask
View Details
Mouse Tissue Inhibitors Of Metalloproteinase 4 (TIMP4) ELISA Kit
MBS2023186-01 24 Strip Well

Mouse Tissue Inhibitors Of Metalloproteinase 4 (TIMP4) ELISA Kit

Ask
View Details