Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTLA-4, Mouse (HEK293, His)

CTLA-4 Protein, Mouse (HEK293, His) is a recombinant CTLA-4 protein with a His-flag. CTLA-4 Protein is a single-pass type I membrane protein and belongs to the CD28 receptor family. CTLA-4 is a negative immune regulator constitutively expressed on Treg cells[1][2].

Product Specifications

Product Name Alternative

CTLA-4 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ctla-4-protein-mouse-hek-293-his.html

Purity

95.00

Smiles

AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Molecular Formula

12477 (Gene_ID) P09793 (A37-D161) (Accession)

Molecular Weight

14-30 kDa

References & Citations

[1]Behzad Rowshanravan, et al. CTLA-4: a moving target in immunotherapy. Blood. 2018 Jan 4;131 (1) :58-67.|[2]Noriko Mitsuiki, et al. What did we learn from CTLA-4 insufficiency on the human immune system?Immunol Rev. 2019 Jan;287 (1) :33-49.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIR Antibody
orb433386 0.1 mg

KIR Antibody

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 RNA ligase 2 (Y10A)
orb2658762-01 20 µg

Recombinant Enterobacteria phage T4 RNA ligase 2 (Y10A)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 RNA ligase 2 (Y10A)
orb2658762-02 100 µg

Recombinant Enterobacteria phage T4 RNA ligase 2 (Y10A)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 RNA ligase 2 (Y10A)
orb2658762-03 1 mg

Recombinant Enterobacteria phage T4 RNA ligase 2 (Y10A)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Testis-specific zinc finger protein topi (topi), partial
MBS1395050 Inquire

Recombinant Drosophila melanogaster Testis-specific zinc finger protein topi (topi), partial

Sign In for Pricing
View Details
MAP2K3 Protein Vector (Mouse) (pPB-C-His)
PV198910 500 ng

MAP2K3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details