Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL2, Mouse (His)

BCL2 protein crucially regulates cell death by controlling mitochondrial membrane permeability. It interacts with caspases in a feedback loop, inhibiting their activity. BCL2 prevents cytochrome c release from mitochondria and binds to apoptosis-activating factor (APAF-1) . BCL2 Protein, Mouse (His) is the recombinant mouse-derived BCL2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

BCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcl2-protein-mouse-his.html

Purity

90.0

Smiles

GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Molecular Formula

12043 (Gene_ID) P10417-1 (G5-P205) (Accession)

Molecular Weight

Approximately 26.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Donafenib (Sorafenib D3) 25mg
A21489-25 25 mg

Donafenib (Sorafenib D3) 25mg

Sign In for Pricing
View Details
Antibody diluent
PA2001-01 50 mL

Antibody diluent

Sign In for Pricing
View Details
Antibody diluent
PA2001-02 100 mL

Antibody diluent

Sign In for Pricing
View Details
MAP3K9/MLK1 Antibody
orb1534422 50 µg

MAP3K9/MLK1 Antibody

Sign In for Pricing
View Details
MYBPC3 Rabbit Polyclonal Antibody (BF647)
orb2372379 100 µL

MYBPC3 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Zeaxanthin
TMS2180-01 1 mg

Zeaxanthin

Sign In for Pricing
View Details