Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL2, Mouse (His)

BCL2 protein crucially regulates cell death by controlling mitochondrial membrane permeability. It interacts with caspases in a feedback loop, inhibiting their activity. BCL2 prevents cytochrome c release from mitochondria and binds to apoptosis-activating factor (APAF-1) . BCL2 Protein, Mouse (His) is the recombinant mouse-derived BCL2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

BCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcl2-protein-mouse-his.html

Purity

90.0

Smiles

GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Molecular Formula

12043 (Gene_ID) P10417-1 (G5-P205) (Accession)

Molecular Weight

Approximately 26.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FOXP2, CT (FOXP2, CAGH44, TNRC10, Forkhead box protein P2, CAG repeat protein 44, Trinucleotide repeat-containing gene 10 protein) (MaxLight 750)
MBS6299980-01 0.1 mL

FOXP2, CT (FOXP2, CAGH44, TNRC10, Forkhead box protein P2, CAG repeat protein 44, Trinucleotide repeat-containing gene 10 protein) (MaxLight 750)

Ask
View Details
FOXP2, CT (FOXP2, CAGH44, TNRC10, Forkhead box protein P2, CAG repeat protein 44, Trinucleotide repeat-containing gene 10 protein) (MaxLight 750)
MBS6299980-02 5x 0.1 mL

FOXP2, CT (FOXP2, CAGH44, TNRC10, Forkhead box protein P2, CAG repeat protein 44, Trinucleotide repeat-containing gene 10 protein) (MaxLight 750)

Ask
View Details
HuA/B/C/D Rabbit Polyclonal Antibody
E28PN6918 100 µL

HuA/B/C/D Rabbit Polyclonal Antibody

Ask
View Details
Recombinant Aspartate Aminotransferase 2 (AST2)
SIPD565Hu01-01 10 µg

Recombinant Aspartate Aminotransferase 2 (AST2)

Ask
View Details
Recombinant Aspartate Aminotransferase 2 (AST2)
SIPD565Hu01-02 50 µg

Recombinant Aspartate Aminotransferase 2 (AST2)

Ask
View Details
Recombinant Aspartate Aminotransferase 2 (AST2)
SIPD565Hu01-03 200 µg

Recombinant Aspartate Aminotransferase 2 (AST2)

Ask
View Details