Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL2, Mouse (His)

BCL2 protein crucially regulates cell death by controlling mitochondrial membrane permeability. It interacts with caspases in a feedback loop, inhibiting their activity. BCL2 prevents cytochrome c release from mitochondria and binds to apoptosis-activating factor (APAF-1) . BCL2 Protein, Mouse (His) is the recombinant mouse-derived BCL2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

BCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcl2-protein-mouse-his.html

Purity

90.0

Smiles

GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Molecular Formula

12043 (Gene_ID) P10417-1 (G5-P205) (Accession)

Molecular Weight

Approximately 26.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFBR3L Antibody
A49370-50UL 50 μL

TGFBR3L Antibody

Sign In for Pricing
View Details
Influenza A, Puerto Rico 8/34 (H1N1), Bangkok 1/ 79 (H3N2), Matrix Protein (MaxLight 550)
MBS6255030-01 0.1 mL

Influenza A, Puerto Rico 8/34 (H1N1), Bangkok 1/ 79 (H3N2), Matrix Protein (MaxLight 550)

Sign In for Pricing
View Details
Influenza A, Puerto Rico 8/34 (H1N1), Bangkok 1/ 79 (H3N2), Matrix Protein (MaxLight 550)
MBS6255030-02 5x 0.1 mL

Influenza A, Puerto Rico 8/34 (H1N1), Bangkok 1/ 79 (H3N2), Matrix Protein (MaxLight 550)

Sign In for Pricing
View Details
Anti-BRLF1 Polyclonal Antibody 2
TMAB-03219-01 50 μL

Anti-BRLF1 Polyclonal Antibody 2

Sign In for Pricing
View Details
Anti-BRLF1 Polyclonal Antibody 2
TMAB-03219-02 100 µL

Anti-BRLF1 Polyclonal Antibody 2

Sign In for Pricing
View Details
Anti-BRLF1 Polyclonal Antibody 2
TMAB-03219-03 200 µL

Anti-BRLF1 Polyclonal Antibody 2

Sign In for Pricing
View Details