Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCL2, Mouse (His)

BCL2 protein crucially regulates cell death by controlling mitochondrial membrane permeability. It interacts with caspases in a feedback loop, inhibiting their activity. BCL2 prevents cytochrome c release from mitochondria and binds to apoptosis-activating factor (APAF-1) . BCL2 Protein, Mouse (His) is the recombinant mouse-derived BCL2 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

BCL2 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bcl2-protein-mouse-his.html

Purity

90.0

Smiles

GRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRP

Molecular Formula

12043 (Gene_ID) P10417-1 (G5-P205) (Accession)

Molecular Weight

Approximately 26.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF705C 3'UTR Luciferase Stable Cell Line
TU029382 1.0 mL

ZNF705C 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HMGCL, ID (HMGCL, Hydroxymethylglutaryl-CoA lyase, mitochondrial, 3-hydroxy-3-methylglutarate-CoA lyase) (PE) discontinued
036642-PE 200 µL

HMGCL, ID (HMGCL, Hydroxymethylglutaryl-CoA lyase, mitochondrial, 3-hydroxy-3-methylglutarate-CoA lyase) (PE) discontinued

Sign In for Pricing
View Details
Fish 1-Phosphatidylinositol-4, 5-Bisphosphate Phosphodiesterase Zeta-1 (PLCZ1) ELISA Kit
MBS9911605 Inquire

Fish 1-Phosphatidylinositol-4, 5-Bisphosphate Phosphodiesterase Zeta-1 (PLCZ1) ELISA Kit

Sign In for Pricing
View Details
3- (Phenylcarbamoyl) benzoic acid
RAA77694-01 100 mg

3- (Phenylcarbamoyl) benzoic acid

Sign In for Pricing
View Details
3- (Phenylcarbamoyl) benzoic acid
RAA77694-02 1 g

3- (Phenylcarbamoyl) benzoic acid

Sign In for Pricing
View Details
Goat Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit (PPP1CC) ELISA Kit
MBS9931691 Inquire

Goat Serine/Threonine-Protein Phosphatase PP1-Gamma Catalytic Subunit (PPP1CC) ELISA Kit

Sign In for Pricing
View Details