Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-23, Human (R179Q, HEK293, His)

FGF-23 protein is an important regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It upregulates EGR1 expression through KL, directly reduces PTH secretion, and negatively regulates osteoblast differentiation and matrix mineralization. FGF-23 Protein, Human (R179Q, HEK293, His) is the recombinant human-derived FGF-23 protein, expressed by HEK293 , with C-His labeled tag and R179Q, , , , mutation.

Product Specifications

Product Name Alternative

FGF-23 Protein, Human (R179Q, HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-23-protein-human-r179q-hek293-his.html

Purity

96.0

Smiles

YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Molecular Formula

8074 (Gene_ID) Q9GZV9 (Y25-I251, R179Q) (Accession)

Molecular Weight

Approximately 29-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protocadherin gamma-A11, PCDHGA11 ELISA KIT
ELI-35637h 96 Tests

Human Protocadherin gamma-A11, PCDHGA11 ELISA KIT

Sign In for Pricing
View Details
Rabbit Monoclonal p57 Kip2 Antibody (KIP2/8169R) [DyLight 755]
NBP3-20897IR 0.1 mL

Rabbit Monoclonal p57 Kip2 Antibody (KIP2/8169R) [DyLight 755]

Sign In for Pricing
View Details
Pseudo-UTP
B7972-.05 50 µL (100 mM)

Pseudo-UTP

Sign In for Pricing
View Details
Compound NP-008009
MBS5795260 Inquire

Compound NP-008009

Sign In for Pricing
View Details
TUBB6 (NM_032525) Human Tagged ORF Clone Lentiviral Particle
RC201280L2V 200 µL

TUBB6 (NM_032525) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CBX1 (NM_006807) Human 3' UTR Clone
SC214414 10 µg

CBX1 (NM_006807) Human 3' UTR Clone

Sign In for Pricing
View Details