Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAFFR/TNFRSF13C, Human

BAFF Receptor (B-cell activating factor receptor, BAFF-R), also known as TNFRSF13C and BR3, is a membrane protein of the TNF receptor superfamily which recognizes BAFF. BAFF Receptor is the crucial receptor for B-cell survival and also is a potent costimulator of both B and T cell activation[1]. BAFFR/TNFRSF13C Protein, Human is a recombinant protein produced in E. coli.

Product Specifications

Product Name Alternative

BAFFR/TNFRSF13C Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Cancer-programmed cell death

Assay Protocol

https://www.medchemexpress.com/cytokines/baff-r-protein-human.html

Purity

95.0

Smiles

MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG

Molecular Formula

115650 (Gene_ID) Q96RJ3-1 (M1-G76) (Accession)

Molecular Weight

Approximately 7.8 kDa

References & Citations

[1]Thompson JS, et al. BAFF-R, a newly identified TNF receptor that specifically interacts with BAFF. Science. 2001 Sep 14;293 (5537) :2108-11.|[2]Losi CG, et al. Mutational analysis of human BAFF receptor TNFRSF13C (BAFF-R) in patients with common variable immunodeficiency. J Clin Immunol. 2005 Sep;25 (5) :496-502.|[3]Rodig SJ, et al. BAFF-R, the major B cell-activating factor receptor, is expressed on most mature B cells and B-cell lymphoproliferative disorders. Hum Pathol. 2005 Oct;36 (10) :1113-9.|[4]Thompson N, et al. Exploring BAFF: its expression, receptors and contribution to the immunopathogenesis of Sjögren's syndrome. Rheumatology (Oxford) . 2016 Sep;55 (9) :1548-55.|[5]Carrillo-Ballesteros FJ, et al. B-cell activating factor receptor expression is associated with germinal center B-cell maintenance. Exp Ther Med. 2019 Mar;17 (3) :2053-2060.|[6]Zheng N, et al. BAFF promotes proliferation of human mesangial cells through interaction with BAFF-R. BMC Nephrol. 2015 May 15;16:72.|[7]Ng LG, et al. B cell-activating factor belonging to the TNF family (BAFF) -R is the principal BAFF receptor facilitating BAFF costimulation of circulating T and B cells. J Immunol. 2004 Jul 15;173 (2) :807-17.|[8]Warnatz K, et al. B-cell activating factor receptor deficiency is associated with an adult-onset antibody deficiency syndrome in humans. Proc Natl Acad Sci U S A. 2009 Aug 18;106 (33) :13945-50.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzyltriphenylphosphonium bromide
TRC-B316170-1G 1 g

Benzyltriphenylphosphonium bromide

Sign In for Pricing
View Details
UBN1 Human Gene Knockout Kit (CRISPR)
KN415072 1 Kit

UBN1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Meniscus
CS708766 5x 5 µm

Tissue FFPE Sections, Meniscus

Sign In for Pricing
View Details
FYB Antibody
KC-6117-01 50 μL

FYB Antibody

Sign In for Pricing
View Details
FYB Antibody
KC-6117-02 100 µL

FYB Antibody

Sign In for Pricing
View Details
FYB Antibody
KC-6117-03 1 mL

FYB Antibody

Sign In for Pricing
View Details