Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAFFR/TNFRSF13C, Human

BAFF Receptor (B-cell activating factor receptor, BAFF-R), also known as TNFRSF13C and BR3, is a membrane protein of the TNF receptor superfamily which recognizes BAFF. BAFF Receptor is the crucial receptor for B-cell survival and also is a potent costimulator of both B and T cell activation[1]. BAFFR/TNFRSF13C Protein, Human is a recombinant protein produced in E. coli.

Product Specifications

Product Name Alternative

BAFFR/TNFRSF13C Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Cancer-programmed cell death

Assay Protocol

https://www.medchemexpress.com/cytokines/baff-r-protein-human.html

Purity

95.0

Smiles

MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG

Molecular Formula

115650 (Gene_ID) Q96RJ3-1 (M1-G76) (Accession)

Molecular Weight

Approximately 7.8 kDa

References & Citations

[1]Thompson JS, et al. BAFF-R, a newly identified TNF receptor that specifically interacts with BAFF. Science. 2001 Sep 14;293 (5537) :2108-11.|[2]Losi CG, et al. Mutational analysis of human BAFF receptor TNFRSF13C (BAFF-R) in patients with common variable immunodeficiency. J Clin Immunol. 2005 Sep;25 (5) :496-502.|[3]Rodig SJ, et al. BAFF-R, the major B cell-activating factor receptor, is expressed on most mature B cells and B-cell lymphoproliferative disorders. Hum Pathol. 2005 Oct;36 (10) :1113-9.|[4]Thompson N, et al. Exploring BAFF: its expression, receptors and contribution to the immunopathogenesis of Sjögren's syndrome. Rheumatology (Oxford) . 2016 Sep;55 (9) :1548-55.|[5]Carrillo-Ballesteros FJ, et al. B-cell activating factor receptor expression is associated with germinal center B-cell maintenance. Exp Ther Med. 2019 Mar;17 (3) :2053-2060.|[6]Zheng N, et al. BAFF promotes proliferation of human mesangial cells through interaction with BAFF-R. BMC Nephrol. 2015 May 15;16:72.|[7]Ng LG, et al. B cell-activating factor belonging to the TNF family (BAFF) -R is the principal BAFF receptor facilitating BAFF costimulation of circulating T and B cells. J Immunol. 2004 Jul 15;173 (2) :807-17.|[8]Warnatz K, et al. B-cell activating factor receptor deficiency is associated with an adult-onset antibody deficiency syndrome in humans. Proc Natl Acad Sci U S A. 2009 Aug 18;106 (33) :13945-50.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MZT2A Recombinant Protein (Human)
RP077535 100 µg

MZT2A Recombinant Protein (Human)

Sign In for Pricing
View Details
Mdp1 AAV siRNA Pooled Vector
28273164 1.0 µg

Mdp1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Maspardin (h) -PR
sc-75751-PR 10 µM - 20 µL

Maspardin (h) -PR

Sign In for Pricing
View Details
Lentiviral mouse Clic1 shRNA (UAS) - Lentiviral mouse Clic1 shRNA (UAS, RFP) (100)
GTR15249780 1 Vial

Lentiviral mouse Clic1 shRNA (UAS) - Lentiviral mouse Clic1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
OR8I4P-set siRNA/shRNA/RNAi Lentivector (Human)
35677091 4x 500 ng

OR8I4P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Anti-SLC7A3 Antibody Picoband®, APC Conjugate
A09720-3-APC 100 µg/Vial

Anti-SLC7A3 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details