Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-27, Mouse (HEK293, C-His)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling.IL-27 Protein, Mouse (HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide.

Product Specifications

Product Name Alternative

IL-27 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-27-protein-mouse-228a-a-hek293-c-his.html

Purity

95.31

Smiles

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Formula

50498&246779 (Gene_ID) O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234) (Accession)

Molecular Weight

Approximately 57.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Chicken ChT1-UNLB Antibody
MBS4152158-01 0.1 mg

Anti-Chicken ChT1-UNLB Antibody

Sign In for Pricing
View Details
Anti-Chicken ChT1-UNLB Antibody
MBS4152158-02 5x 0.1 mg

Anti-Chicken ChT1-UNLB Antibody

Sign In for Pricing
View Details
GIGYF1 Antibody (Center)
MBS9208678-01 0.08 mL

GIGYF1 Antibody (Center)

Sign In for Pricing
View Details
GIGYF1 Antibody (Center)
MBS9208678-02 0.4 mL

GIGYF1 Antibody (Center)

Sign In for Pricing
View Details
GIGYF1 Antibody (Center)
MBS9208678-03 5x 0.4 mL

GIGYF1 Antibody (Center)

Sign In for Pricing
View Details
Recombinant Human Activator of HSP90 ATPase-1
7-06909 1 mg

Recombinant Human Activator of HSP90 ATPase-1

Sign In for Pricing
View Details