Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-27, Mouse (HEK293, C-His)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling.IL-27 Protein, Mouse (HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide.

Product Specifications

Product Name Alternative

IL-27 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-27-protein-mouse-228a-a-hek293-c-his.html

Purity

95.31

Smiles

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Formula

50498&246779 (Gene_ID) O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234) (Accession)

Molecular Weight

Approximately 57.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Muscarinic Acetylcholine Receptor M-AChR ELISA Kit
BG-RAT11529 1 Each

Rat Muscarinic Acetylcholine Receptor M-AChR ELISA Kit

Sign In for Pricing
View Details
Mouse lymphocyte function associated antigen 3 ( (LFA-3/CD58) ELISA Kit
GA-E0723MS-01 48 Tests

Mouse lymphocyte function associated antigen 3 ( (LFA-3/CD58) ELISA Kit

Sign In for Pricing
View Details
Mouse lymphocyte function associated antigen 3 ( (LFA-3/CD58) ELISA Kit
GA-E0723MS-02 96 Tests

Mouse lymphocyte function associated antigen 3 ( (LFA-3/CD58) ELISA Kit

Sign In for Pricing
View Details
TAS2R60 Human shRNA Lentiviral Particle (Locus ID 338398)
TL301221V 500 µL Each

TAS2R60 Human shRNA Lentiviral Particle (Locus ID 338398)

Sign In for Pricing
View Details
3-Amino-2,3-dideoxy-D-myo-inositol
TRC-A206660-75MG 75 mg

3-Amino-2,3-dideoxy-D-myo-inositol

Sign In for Pricing
View Details
PCMV-Arpc2-3xFLAG-Neo Plasmid
PVT79075 2 µg

PCMV-Arpc2-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details