Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-27, Mouse (HEK293, C-His)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling.IL-27 Protein, Mouse (HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide.

Product Specifications

Product Name Alternative

IL-27 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-27-protein-mouse-228a-a-hek293-c-his.html

Purity

95.31

Smiles

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Formula

50498&246779 (Gene_ID) O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234) (Accession)

Molecular Weight

Approximately 57.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1305298 (NM_001134526) Rat Untagged Clone
RN208986 10 µg

RGD1305298 (NM_001134526) Rat Untagged Clone

Sign In for Pricing
View Details
RAR alpha Recombinant Antibody, PE-Cy5 Conjugated
bsm-61299R-PE-Cy5-01 20 µL

RAR alpha Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
RAR alpha Recombinant Antibody, PE-Cy5 Conjugated
bsm-61299R-PE-Cy5-02 100 µL

RAR alpha Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Pigeon Zinc Finger Protein 36, C3H1 Type-Like 1 (ZFP36L1) ELISA Kit
MBS9912729 Inquire

Pigeon Zinc Finger Protein 36, C3H1 Type-Like 1 (ZFP36L1) ELISA Kit

Sign In for Pricing
View Details
Human SOST (Sclerostin) ValidElisa Kit
EK340830 96 Well

Human SOST (Sclerostin) ValidElisa Kit

Sign In for Pricing
View Details
RGS5 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV693486 1.0 µg DNA

RGS5 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details