Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-27, Mouse (HEK293, C-His)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling.IL-27 Protein, Mouse (HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide.

Product Specifications

Product Name Alternative

IL-27 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-27-protein-mouse-228a-a-hek293-c-his.html

Purity

95.31

Smiles

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Formula

50498&246779 (Gene_ID) O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234) (Accession)

Molecular Weight

Approximately 57.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL6P21 sgRNA CRISPR Lentivector (Human) (Target 3)
K1880404 1.0 µg DNA

RPL6P21 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
PLV3-U6-Trim28-sgRNA3-Cas9-Puro Plasmid
PVT65909 2 µg

PLV3-U6-Trim28-sgRNA3-Cas9-Puro Plasmid

Sign In for Pricing
View Details
Human Integral membrane protein GPR180, GPR180 ELISA KIT
ELI-48535h 96 Tests

Human Integral membrane protein GPR180, GPR180 ELISA KIT

Sign In for Pricing
View Details
Lentiviral mouse Mpi shRNA (UAS) - Lentiviral mouse Mpi shRNA (UAS, RFP) plasmid
GTR15180661 1 Vial

Lentiviral mouse Mpi shRNA (UAS) - Lentiviral mouse Mpi shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Ropporin-1B Antibody (Biotin)
abx105899-01 20 µg

Ropporin-1B Antibody (Biotin)

Sign In for Pricing
View Details
Ropporin-1B Antibody (Biotin)
abx105899-02 50 µg

Ropporin-1B Antibody (Biotin)

Sign In for Pricing
View Details