Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-27, Mouse (HEK293, C-His)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling.IL-27 Protein, Mouse (HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide.

Product Specifications

Product Name Alternative

IL-27 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-27-protein-mouse-228a-a-hek293-c-his.html

Purity

95.31

Smiles

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Formula

50498&246779 (Gene_ID) O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234) (Accession)

Molecular Weight

Approximately 57.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DFNA41 Protein Vector (Human) (pPB-C-His)
PV072921 500 ng

DFNA41 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Ythdc2 3'UTR GFP Stable Cell Line
TU172443 1.0 mL

Ythdc2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human ST8SIA1 Affinity Purified Polyclonal Ab
AF6716 100 µg

Human ST8SIA1 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Mouse monoclonal Centrin 1 Antibody (OTI1E1)
NBP2-46253 0.1 mL

Mouse monoclonal Centrin 1 Antibody (OTI1E1)

Sign In for Pricing
View Details
Villin (VIL1) Rabbit Polyclonal Antibody
TA358828 100 µL

Villin (VIL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDK12 Polyclonal Antibody
MBS2573683-01 0.06 mL

CDK12 Polyclonal Antibody

Sign In for Pricing
View Details