Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-27, Mouse (HEK293, C-His)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling.IL-27 Protein, Mouse (HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide.

Product Specifications

Product Name Alternative

IL-27 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-27-protein-mouse-228a-a-hek293-c-his.html

Purity

95.31

Smiles

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Formula

50498&246779 (Gene_ID) O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234) (Accession)

Molecular Weight

Approximately 57.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp407 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
50959124 3x 1.0µg DNA

Zfp407 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Quiescin Q6 Sulfhydryl Oxidase 1 (QSOX1) ELISA Kit
RD-QSOX1-Mu-01 96 Tests

Mouse Quiescin Q6 Sulfhydryl Oxidase 1 (QSOX1) ELISA Kit

Sign In for Pricing
View Details
Mouse Quiescin Q6 Sulfhydryl Oxidase 1 (QSOX1) ELISA Kit
RD-QSOX1-Mu-02 48 Tests

Mouse Quiescin Q6 Sulfhydryl Oxidase 1 (QSOX1) ELISA Kit

Sign In for Pricing
View Details
Human MATN1 qPCR Primer Pair
QH17889S 200 Tests

Human MATN1 qPCR Primer Pair

Sign In for Pricing
View Details
Pmf1 ORF Vector (Mouse) (pORF)
ORF054355 1.0 µg DNA

Pmf1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Canine 7-Dehydrocholesterol Reductase ELISA Kit
MBS072173-01 48 Well

Canine 7-Dehydrocholesterol Reductase ELISA Kit

Sign In for Pricing
View Details