Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-27, Mouse (HEK293, C-His)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling.IL-27 Protein, Mouse (HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide.

Product Specifications

Product Name Alternative

IL-27 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-27-protein-mouse-228a-a-hek293-c-his.html

Purity

95.31

Smiles

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Formula

50498&246779 (Gene_ID) O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234) (Accession)

Molecular Weight

Approximately 57.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nrm ORF Vector (Rat) (pORF)
ORF071520 1.0 µg DNA

Nrm ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
2-Hydroxyadipic acid 25mg
A18809-25 25 mg

2-Hydroxyadipic acid 25mg

Sign In for Pricing
View Details
IMPACT (NM_018439) Human Untagged Clone
SC324621 10 µg

IMPACT (NM_018439) Human Untagged Clone

Sign In for Pricing
View Details
Human RPS6KA6 knockdown cell line
ABC-KD13190 1 Vial

Human RPS6KA6 knockdown cell line

Sign In for Pricing
View Details
QTRT1 Human shRNA Plasmid Kit (Locus ID 81890)
TR302167 1 Kit

QTRT1 Human shRNA Plasmid Kit (Locus ID 81890)

Sign In for Pricing
View Details
Mouse Monoclonal Melanocortin-5 R/MC5R Antibody (821012) [mFluor Violet 500 SE]
FAB8205MFV500 0.1 mL

Mouse Monoclonal Melanocortin-5 R/MC5R Antibody (821012) [mFluor Violet 500 SE]

Sign In for Pricing
View Details