Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-27, Mouse (HEK293, C-His)

The IL-27 protein together with IL23A forms IL-23 interleukin, a key cytokine in innate and adaptive immunity. It is associated with infection responses, binds to IL12RB1 and IL23R receptor complexes, and activates Jak-Stat signaling.IL-27 Protein, Mouse (HEK293, C-His) is a recombinant protein dimer complex containing IL-27 Protein and IL-27A, expressed by HEK293 , with C-10*His labeled tag and GSGSGGSGGSGSGKL peptide.

Product Specifications

Product Name Alternative

IL-27 Protein, Mouse (HEK293, C-His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-27-protein-mouse-228a-a-hek293-c-his.html

Purity

95.31

Smiles

YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPGSGSGGSGGSGSGKLFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS

Molecular Formula

50498&246779 (Gene_ID) O35228 (Y19-P228) &GSGSGGSGGSGSGKL &Q8K3I6 (F29-S234) (Accession)

Molecular Weight

Approximately 57.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Thyroid gland
CB505518 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
Acot6 3'UTR Luciferase Stable Cell Line
TU101276 1.0 mL

Acot6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Chlamydophila caviae Triosephosphate isomerase (tpiA)
MBS1396383-01 0.02 mg (E-Coli)

Recombinant Chlamydophila caviae Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Chlamydophila caviae Triosephosphate isomerase (tpiA)
MBS1396383-02 0.1 mg (E-Coli)

Recombinant Chlamydophila caviae Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Chlamydophila caviae Triosephosphate isomerase (tpiA)
MBS1396383-03 0.02 mg (Yeast)

Recombinant Chlamydophila caviae Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details
Recombinant Chlamydophila caviae Triosephosphate isomerase (tpiA)
MBS1396383-04 0.1 mg (Yeast)

Recombinant Chlamydophila caviae Triosephosphate isomerase (tpiA)

Sign In for Pricing
View Details