Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-1, Mouse (N-His)

The FGF-1 protein plays a key role in regulating a variety of cellular processes, serving as a potent mitogen and ligand for FGFR1 and integrins. In the presence of heparin, FGF-1 binds to FGFR1, initiating dimerization and autophosphorylation, resulting in multiple signaling cascades. FGF-1 Protein, Mouse (N-His) is the recombinant mouse-derived FGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-1 Protein, Mouse (N-His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-1-protein-mouse-n-his.html

Purity

98.0

Smiles

FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Formula

14164 (Gene_ID) P61148 (F16-D155) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin V Binding Buffer (10x)
EXB0019 50 mL

Annexin V Binding Buffer (10x)

Sign In for Pricing
View Details
Bovine PREP / Prolyl endopeptidase ELISA Kit
MBS2906447-01 48 Well

Bovine PREP / Prolyl endopeptidase ELISA Kit

Sign In for Pricing
View Details
Bovine PREP / Prolyl endopeptidase ELISA Kit
MBS2906447-02 96 Well

Bovine PREP / Prolyl endopeptidase ELISA Kit

Sign In for Pricing
View Details
Bovine PREP / Prolyl endopeptidase ELISA Kit
MBS2906447-03 5x 96 Well

Bovine PREP / Prolyl endopeptidase ELISA Kit

Sign In for Pricing
View Details
Bovine PREP / Prolyl endopeptidase ELISA Kit
MBS2906447-04 10x 96 Well

Bovine PREP / Prolyl endopeptidase ELISA Kit

Sign In for Pricing
View Details
Oxalic Acid Test Reagent
RA-010 100 Tests/Box

Oxalic Acid Test Reagent

Sign In for Pricing
View Details