Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF-1, Mouse (N-His)

The FGF-1 protein plays a key role in regulating a variety of cellular processes, serving as a potent mitogen and ligand for FGFR1 and integrins. In the presence of heparin, FGF-1 binds to FGFR1, initiating dimerization and autophosphorylation, resulting in multiple signaling cascades. FGF-1 Protein, Mouse (N-His) is the recombinant mouse-derived FGF-1 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

FGF-1 Protein, Mouse (N-His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fgf-1-protein-mouse-n-his.html

Purity

98.0

Smiles

FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Molecular Formula

14164 (Gene_ID) P61148 (F16-D155) (Accession)

Molecular Weight

Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Coiled Coil Domain Containing Protein 3 (CCDC3) ELISA Kit
201-12-2470 96 Tests

Human Coiled Coil Domain Containing Protein 3 (CCDC3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human RETN Protein, N-His
bs-102540P-01 20 µg

Recombinant Human RETN Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RETN Protein, N-His
bs-102540P-02 50 µg

Recombinant Human RETN Protein, N-His

Sign In for Pricing
View Details
OR2Y1 Antibody
CSB-PA007163-01 50 µg

OR2Y1 Antibody

Sign In for Pricing
View Details
OR2Y1 Antibody
CSB-PA007163-02 100 µg

OR2Y1 Antibody

Sign In for Pricing
View Details
SCRN3 Rabbit Polyclonal Antibody (AP)
orb965246 100 µL

SCRN3 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details