Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tumor rejection antigen P815A (Trap1a), partial

Product Specifications

Abbreviation

Recombinant Mouse Trap1a protein, partial

Gene Name

Trap1a

UniProt

P19473

Expression Region

1-134aa

Organism

Mus musculus (Mouse)

Target Sequence

MSDNKKPDKAHSGSGGDGDGNRCNLLHRYSLEEILPYLGWLVFAVVTTSFLALQMFIDALYEEQYERDVAWIARQSKRMSSVDEDEDDEDDEDDYYDDEDDDDDAFYDDEDDEEEELENLMDDESEDEAEEEMS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.1 kDa

References & Citations

"Trap1a is an X-linked and cell-intrinsic regulator of thymocyte development." Li C.S., Tang F., Zhang P., Jiang T., Saunders T.L., Zheng P., Liu Y. Cell Mol Immunol 14:685-692 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-100 1x 100 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-100 1x 100 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-100 1x 100 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
BNC680177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details